HappyMod › Games › Casual › Snail Bob 2 Mod
Snail Bob 2 Mod

Snail Bob 2 Mod APK 1.5.17 [Remove ads][Mod speed]

Update on: 2024-03-13

Snail Bob 2 Mod is a modified version of Snail Bob 2 developed by Herocraft Ltd. The difference between mod version and original version is: Speed Hack / No Ads... You can download latest mod version or original version of Snail Bob 2 1.5.26 with HappyMod. HappyMod is the best mod downloader for 100% working mods. Click here to learn how to use HappyMod to download and install all kinds of file types:xapk, bapk, apks...
App nameSnail Bob 2 Mod APK 1.5.17 [Remove ads][Mod speed]
Version1.5.17
Update on2024-03-13
Size134.52 MB
Mod infoSpeed Hack / No Ads
DeveloperHerocraft Ltd
Ringtone DownlaodGame Bgm Ringtone
CategoryCasual
Get it on Google PlaySnail Bob 2
Download original apkSnail Bob 2 (136.2 MB)
Other Apps
from this developer
Pirates Flag-Open-world RPG Mod APK
Tempest: Pirate RPG Premium Mod APK
Sandbox: Strategy & Tactics-WW Mod APK
SRGT-Racing & Car Driving Game Mod APK
Farm Frenzy:Legendary Classics Mod APK
Farm Frenzy Premium Mod APK
Red Ball 3: Jump for Love! Bou Mod APK
Strategy & Tactics 2 Mod APK
Armor Age: WW2 tank strategy Mod APK
King of Dragon Pass: Text RPG Mod APK
Zombie Derby Mod APK
Gibbets:Bow Master!Arrow Games Mod APK
Warhammer 40,000: Space Wolf Mod APK
Snail Bob 2 Mod APK
Space Arena: Construct & Fight Mod APK
Tap Tap: Idle City Builder Sim Mod APK
Learn 2 Fly: bounce & fly! Mod APK
Ragdoll Rage: Heroes Arena Mod APK
Majesty: The Fantasy Kingdom Mod APK
Strategy & Tactics: Medieval C Mod APK
Download Links:

Snail Bob 2 Mod APK 1.5.17 [Remove ads][Mod speed]

Fast Download (17.4 MB)
Use HappyMod App to get faster download!
Download APK (134.52 MB)
* All mod apks are uploaded by users. If there is any infrigement, please send contact us to remove it.

# Mod Info

The main advantages / modifications of Snail Bob 2 Mod APK 1.5.17 [Remove ads][Mod speed]

Speed Hack / No Ads

# Useful Facts

In the game Snail Bob 2 Adventure, players take on the role of Bob, a snail hero who must rescue his fellow snails from dangerous matches and difficult tasks. The game features clever puzzles and colorful, whimsical graphics that appeal to all ages. It can be downloaded for free from the game’s website. The adventure game Snail Bob 2 Adventure requires players to use available tools in each mission. However, the rescue game Cut the Rope green frog categorically appears to players as cleverly planned. This is because it's a thinking game that people can't see through even if they do notice. When you start a new game, the first few levels won’t be too difficult to get used to. However, as you continue through each level, new obstacles will gradually appear. You’ll earn a star for each door you open and need three stars to progress to the next level. Snail Bob 2 Adventure is full of challenging situations that make it difficult to play. In Snail Bob 2 Adventure, Bob travels with a sense of humor and great joy. The journey through nature, precarious traps, and dangerous predators is intimidating and frightening. However, the imagery of Bob's journey is bright and cheery— presenting a much different impression than people expected. Snail Bob Adventure 2 is a role-playing game that is perfect for playing with friends and family. It has over 30 levels; each one is full of adventure and puzzles that help Bob collect stars for his snail. If you want to adventure with a snail, don't miss Snail Bob Adventure 2! It's the ideal game for exploring ancient Egypt with Bob.

# Key features of the device include: — a touchscreen display; — a built-in camera; and — a speaker that connects through the headphone jack.

In Snail Bob 2, you and the snail Bob adventure into mysterious islands to uncover secrets and mysteries. Build a prosperous snail city together as you tackle challenging levels. Bob the snailsnail still transforms into a beautiful creature when playing the game. Players explore the mysterious and mystical to create new Bob towns with their friends through challenges related to different levels. The game is easy enough for younger audiences to play. They don't need to press the navigation button; instead, they control the snail by rolling forward and pulling mechanisms. Additionally, the fire needs to be extinguished with a lever. In order to play the game, all the player needs to do is move the screen to the left or right by sliding it. They can also touch the screen to interact with objects or move around in a specific direction. This new gameplay will have specific instructions that help players quickly get used to the game. The unique thing about Snail Bob 2 is that it allows the player to transform into a real-life snail to become stronger. Bob can shoot cannons or travel at high speed when he has a Super Shell in his possession. Bob is a cute snail who loves to be adored. You should collect the treasure chests and stars you find on your adventures so Bob can wear a wide array of unique outfits. These looks will make you love Bob even more. This game will include daily incentives for players to play, a special spin mode that gives players extra rewards, and many unique rewards accessible only through special products. This game's motivation system also helps players get these unique rewards quickly and conveniently. Kid Friendly and Easy to Play: The game's aim is to provide entertaining and relaxing gaming moments for all ages. This is accomplished through the use of vivid colors, bright backgrounds and music that is gentle and easy to listen to. Additionally, the game uses visuals and graphics of Bob in a playful manner that encourages players to follow him as he dances around. Lastly, the game includes musical melodies and sounds that are cute, fun and easy to listen to.

# To measure the effectiveness of an education program, educators use a score derived from multiple assessments. These assessments combine scores from multiple subjects to create overall assessments.

Chillingo is a successful mobile game publisher with a consistent weekly volume. They were struggling to find an alternative solution when they couldn’t compete with other games. Chillingo decided to release Snail Bob as a direct competitor to Angry Birds and Cut The Rope. This game wasn’t gaudy; it was more unusual than that. It also required players to perform an action that was strange and unnatural. A product we want to introduce in a friendly game is slimey snail, which we control. Snail Bob 2 is a physics-based puzzle game that requires players to control Bob to find a route out between each level. Bob can move forward and touch his shell so he can camouflage himself; he can also enter his shell to hide sometimes. Additionally, the village is looking for three hidden stars around the area. The game's developer implemented special features to aid players in finding each level's hidden secrets. These include objects that are well hidden, such as behind furniture, or disguised as common places. Each level has an excellent design that doesn’t reuse any parts from previous levels. Additionally, the puzzles on each level help increase Bob’s popularity. By playing a game without IAP, players always find more reasons to love their game. Pulling levers, pressing buttons and completing a sequence can all be exhilarating. Plus, anyone who doesn't understand these statements is lost. While the game does have a few poor aspects, such as a lackluster story and unappealing characters, many people dislike Snail Bob for its garish visuals. Some even think the character is shiny and bright; despite this, others praise Bob’s detailed environment. Music with pop tracks is preferable to music with boring and annoying music.

# The last words are the most important aspect of a final statement.

Snail Bob 2 is an average puzzle game that can be played on the CH Play. The lack of personality in the game makes it worse than other puzzle games that came before it. However, the way it seamlessly combines tracing puzzles and puzzle solving makes many generations fall in love with it. Bob, a loveable snail, and entertaining gameplay make for the most enjoyable gaming experiences. Download the Snail B app now!b 2 now and go on your adventure now.

# Snail Bob 2 Mod APK 1.5.17 [Remove ads][Mod speed] Features:

Snail Bob needs your help again! Finally fully FREE version!As in the original game Bob simply crawls onwards regardless of the situation. And your job is to press buttons, switch levers, move platforms and activate other machines to not give Bob to perish or be gobbled. Snail Bob 2 is good for players of all ages and skills. This is a good and funny game, which makes rack your brain but won't break it and definitely makes you smile :)- 90 levels spread across 3 unique worlds
- Dressing Bob in tons of different outfits (you can even dress up him in Pixel, After Shower and Dragon costumes)
- Find all hidden stars and jigsaw pieces (many hidden objects on levels)
- Great family puzzle perfect suitable for kids and for adults, and also to play together
- Sequel of the famous web-game that has been played over a billion times!If you wish to play Snail Bob 2 without any ads or IAP's we have special Deluxe version for you here:
https://play.google.com/store/apps/details?id=com.tinybuild.snailbob2

Useful Facts
Key features of the device include: — a touchscreen display; — a built-in camera; and — a speaker that connects through the headphone jack.
To measure the effectiveness of an education program, educators use a score derived from multiple assessments. These assessments combine scores from multiple subjects to create overall assessments.
The last words are the most important aspect of a final statement.

# How to download and install Snail Bob 2 Mod APK 1.5.17 [Remove ads][Mod speed]?

// Option A //

To download Snail Bob 2 mod from HappyMod.com.
You need enable the option "Unknown Sources".
1. Click on the above link to download Snail Bob 2 mod APK.
2. Save the file in your device Downloads folder.
3. Now tap on Install and wait for the installation to finish.
4. Once it is done, open the game and start playing it right away.

// Option B //

To download Snail Bob 2 from HappyMod APP, you can follow this:
1. Open your browser and download the HappyMod APK file from HappyMod.com - the only official website of HappyMod.
2. Open Android Settings and go into Privacy or Security.
3. Tap the option to Allow Unknown Sources and enable it.
4. Go to your Android downloads and tap the APK file.
5. Follow the directions on the screen to install it.
6. Search Snail Bob 2 in HappyMod App.

# Full Specifications of Snail Bob 2 Mod APK 1.5.17 [Remove ads][Mod speed]

// Download Information //

Size134.5MB
Version1.5.17
Version Code98
Langaf am ar as az be bg bn bo bs ca cs da de de-DE el en en-AU en-CA en-GB en-IN en-SG en-XC es es-419 es-ES es-US et eu fa fi fil fr fr-CA gl gu hi hr hu hy id in is it iw ja ja-JP ka kk km kn ko ky lo lt lv mk ml mn mr ms my nb ne nl no or pa pl pt pt-BR pt-PT ro ru si sk sl sq sr sr-Latn sv sw ta te th tl tr tw uk ur uz vi zh zh-CN zh-HK zh-MO zh-TW zu

More...[+]

// Operation Systems //

PermissionINTERNET ACCESS_NETWORK_STATE AD_ID CHANGE_WIFI_MULTICAST_STATE ACCESS_WIFI_STATE BIND_GET_INSTALL_REFERRER_SERVICE BIND_APPHUB_SERVICE ACCESS_ADSERVICES_AD_ID ACCESS_ADSERVICES_ATTRIBUTION ACCESS_ADSERVICES_TOPICS WAKE_LOCK DYNAMIC_RECEIVER_NOT_EXPORTED_PERMISSION RECEIVE FOREGROUND_SERVICE BILLING
Permission Text OTHER:
OTHER:
Allows applications to open network sockets.
Allows applications to access information about networks.
Allows applications to enter Wi-Fi Multicast mode.
Allows applications to access information about Wi-Fi networks.
Allows using PowerManager WakeLocks to keep processor from sleeping or screen from dimming.
Min Sdk21
Min Sdk TxtAndroid 5.0 (LOLLIPOP)
Target Sdk33
Target Sdk Txt33
Multi WindowNo
Supports Screenssmall, normal, large, xlarge
CPUarm64-v8a armeabi-v7a
Open GL Int0
Supports Any DensityYes
Densities120, 160, 240, 320, 480, 640, 65534, 65535

// User Features //

Uses Feature Wi-Fi hardware features:
The app uses 802.11 networking (Wi-Fi) features on the device.
Uses Feature Touchscreen hardware features:
The app uses the Global System for Mobile Communications (GSM) telephony radio system.
The app uses the device's basic two-point multitouch capabilities, such as for pinch gestures, but the app does not need to track touches independently. This is a superset of the android.hardware.touchscreen feature.
The app uses the device's advanced multitouch capabilities for tracking two or more points independently. This feature is a superset of the android.hardware.touchscreen.multitouch feature.
Uses Feature The app requires the device to use the portrait or landscape orientation. If your app supports both orientations, then you don't need to declare either feature.#The app uses 802.11 networking (Wi-Fi) features on the device.#:

// Signature //

Md5579D68614FFB4EB1E7F8F6AD0DDBBF76
SignatureA7B3774480C00C2064EA19F159906241F9F9D225
Sha256AB9E09A265FEBB9CD0AD883E0F2E56D098665237F0B26B6B6C0912CB4A5889A0
Valid FromFri Apr 26 05:42:17 CEST 2019 until: Sun Apr 18 05:42:17 CEST 2049
Serial Number2a9d19b2

// Developer //

# What're users talking about Snail Bob 2 Mod APK

Download HappyMod to join real time talk with millions of users.

  • User reviews
  • User requests

Write a review for Snail Bob 2 Mod APK

Rate it:

Average rating out of 32

Submit a review

User reviews (32)

A

@Anonymous   2024-11-08 16:44:15

From:AE   Device:SM-G998B   OS:android 14
علمني اخي

I

@Anonymous   2024-10-16 21:51:52

From:IT   Device:Lenovo TB-X306F   OS:android 11
Funziona come l'originale consiglio di installarlo.

I

@Anonymous   2024-10-02 00:45:44

From:IQ   Device:SM-G610F   OS:android 7.0
y7 s8 u6 o9

K

@Anonymous   2024-08-29 22:09:49

From:KZ   Device:RMO-NX1   OS:android 13
no update

U

@Anonymous   2024-08-04 05:22:54

From:US   Device:HUAWEI MLA-L11   OS:android 7.0
cool

E

@Anonymous   2024-07-30 19:20:24

From:EG   Device:Infinix X6511B   OS:android 11
مش ب تفتح

D

@Anonymous   2024-07-22 02:21:11

From:DE   Device:SM-X700   OS:android 14
Not ads free!!

U

@Anonymous   2024-07-16 20:42:14

From:US   Device:TECNO KI5k   OS:android 12
nada de funcionar

G

@Anonymous   2024-03-24 14:33:00

From:GB   Device:M2101K7AG   OS:android 12
amazing

K

@Anonymous   2022-02-24 19:25:54

From:KZ   Device:SM-A013F   OS:android 10
оно вылетает почему а а а а .а

More...[+]

Request a latest version of Snail Bob 2 Mod

If this mod doesn't work, you can send a request to HappyMod community. Users will upload a new mod if they've one.
Send a request

Latest requests related to Snail Bob 2

I

@Anonymous   2020-12-16 00:27:15

From:IN   Device:LENOVO Lenovo TB-8504X   OS:android 8.1.0
tt r judging for hood tt ii****cudhdyrbdyftfdfjfjfijcjfaeasq esq w exchanging n!n!n!nmnkjljoipipikhknkukhkhkwf are q few sxcxvxnn?jl

I

@Anonymous   2019-08-07 16:15:22

From:IN   Device:LAVA Z81   OS:android 8.1.0
good morning I am samundar so you arefnsmksfksflgwlsglegkwkqfkafkwtkstmfsmsfktsktakatkrwkrqksgfthhhgffffbfajzgnhhdmv.zv vC CA D fa fa fanfanfqbfwnfwnfwntwn

Logo

HappyMod

Best mod downloader
for 100% working mods.

Snail Bob 2 Mod apk ~ download faster with HappyMod.

Related Mods

People who download Snail Bob 2 Mod also like...

Defence Sniper  3D Mod Apk 1.1.0 [Unlocked]

Defence Sniper 3D Mod Apk 1.1.0 [Unlocked]

The game has been unlocked all the levels
Apocalypse Max Mod Apk 0.55
Komodo Dragon Rampage 2016 Mod Apk 1.2 [Unlimited money]

Komodo Dragon Rampage 2016 Mod Apk 1.2 [Unlimited money]

Each of the after levels get a lot of currency.
Rallycross Mod Apk 1.24 [Unlimited money]

Rallycross Mod Apk 1.24 [Unlimited money]

Into the game giving away large amounts of currency.
Bakery GO Chef Heroes APK Mod Apk 1.4 [Unlimited money]
SquareStack - Zen Casual Game Mod Apk 1.12 [Unlocked]

SquareStack - Zen Casual Game Mod Apk 1.12 [Unlocked]

The game has been unlocked all for map

More...[+]

100% working mods + super fast download